SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|166608 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|166608
Domain Number 1 Region: 151-270,302-353
Classification Level Classification E-value
Superfamily vWA-like 0.0000000111
Family Integrin A (or I) domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|166608
Sequence length 956
Sequence
MKSPPNDVIVKRHRYYPPTHSPLQSRVYVGTVSGVLMVYPNINNDVITYRQYNNYSELSA
DDEERKDEAEKNVLEKDTKHEDEIGRNDDNYVGNSSDESVGDGGGSGHSGIGGSGSGSGG
AGASVVVDENVTGNVDNDLAEFRLQSWFLGKLNQAKHVAELLINTFTSHYYINVISSSSM
IWDIQGHPIDQTTTALSCKNADDGNQGCGLYPANDHNKKTFLRLIHKLKPRGGTDLHRAF
DLAFDMMKLNGKSCIKHIYLITSARDSDKKVRCSSGTIHFLEDNQKKFAAGNTCKYNMDR
IEMAVSIMQYYASHTIDIYTFVTSSQYVSYSRISNLACHNGGFSIWINGTNNYTKQLRLY
IEAVLYSSPNSSFDIDTSTLLSTDTKSSIHISLPVFILSDDNRQETDEEVLTENSEKIVG
VVGFELSYTHLHNLLMRKLWKGSDVFLVHAWNLMVPLHHKMIPINEQFRHDLSLNMVVNP
TNSLKEYQQIVKTITDMTSPTTLVVTSIPKIPLITMSNTIVTPEYSYDPAGSSSPTLTYQ
DKNNMNVGDGNESLFYYFAPIKNQHFNLEKNASSLGLSMLAFCDMEMFADQFDPTKFLDL
EDYLNGPNEPKSSKECTLIQPDTSLEIEISQTMEEHWKDTLTLPSPNIKMRYDDVIDSRY
LLSANGVMRVFPAVHLKADLLMDAHHEDWFKDALAYRFTLAVTPGKHTRNFQSNRRNLIS
LNRAVLYPCGASTTGKCLTSEIWAVVGTSIRMNIFVSRLATLINRKYEISCGTSDMNCYI
IRNNLQVVFELRTDPQASQPSIIELFPEELQFLMKHKNKRQHDKQRQEPCVRHADEYVIV
KAKHAKTYNTSCQMRTVHLVPVSNTNVFLLVFKTATTSENKKCAKKWVSHYKSEYFIQRP
SFLPPRHGNRSCDLPVFVPLPCVTPLRACQIQGLTVHFIIGALLTFYFSIQIHDSY
Download sequence
Identical sequences T1EYA5
jgi|Helro1|166608 XP_009010084.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]