SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|167059 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|167059
Domain Number 1 Region: 331-415
Classification Level Classification E-value
Superfamily Immunoglobulin 1.84e-16
Family I set domains 0.013
Further Details:      
 
Domain Number 2 Region: 429-466
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000755
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|167059
Sequence length 623
Sequence
MTSLYLLLPQKNRPLQATEATTFLTSNFIYYCLLLLLLTTATSTLSRTNAASIDVEPSYW
QNHQRSVVSPRSLCEEWRHDVASRATVSKLIVEGRVKKIDDSSSRASRSNFQSDKSLLYF
NVTFKPRVVYKGYLPKQIYNNNVNSNSVSSNNNKNNNNYPMLVVGVFGRKEDAGSCTPSI
QLGTNYIMFLKFNPSTYDVLMTSSSSSPSYDYNADENDDGGDDDDEVHDVFDDADNDSVI
NVKNNDNKRNKKSKMNAYNNSEEEDEEDDDDDGGGGNDNDDLPVGSDVRPYFEIDQFPEL
TSRRALRSVAEFSCKNCSSMPTIEPMAEKRKQVIANQKLLLRCVTHGRPAPLVTWFKNGD
VLNTTVKRISVKNSRDGTSTLHIDKIKSSDSGIFQCSAKNILGDVISEGVDVIVLTESQI
NDIPQYGPCDVLDYCLNGGTCHSQLKTGAKVCECRQNYTGPRCQEFNVVEHVILMRDKYE
KFEKRLESLVMTSLLLIVILIFLFIVVIVFLTRRRFKQARTGSTTTTTTATSLICNNNNN
NNNVNNNVNSKKSCNGTAVRASYIQQKQQQQQLRLSQQPQQPQHQQQLQMQPMKEIKVRK
ICNDFSSMFSKPRCNLSIRSLLT
Download sequence
Identical sequences T1EYY7
XP_009010826.1.102002 jgi|Helro1|167059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]