SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|167120 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|167120
Domain Number - Region: 89-128
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00251
Family EGF-type module 0.034
Further Details:      
 
Domain Number - Region: 61-79
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0464
Family EGF-type module 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|167120
Sequence length 147
Sequence
MTSNNTRNSLMGYTKKFESKFVHTHENVTSDYTCLLICLHFQLVSKCKDPEIIGTIFDEI
AKQCSCAPGWKGILCSERDWIVDVDCKKDCSVNQGGCGPKQVCLVSLINKKPWTECACIP
GYLRVDYYTCKGHTYAHRLIGQSNYTK
Download sequence
Identical sequences T1EZ18
jgi|Helro1|167120 XP_009010883.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]