SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|167138 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|167138
Domain Number 1 Region: 255-299
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000355
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|167138
Domain Number - Region: 217-272
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00415
Family EGF-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|167138
Sequence length 354
Sequence
MCLDICLSNEYIFASNMKGHQCMCAMNVTGESHMLEDCLPKNQLPPKYFLVFLVKKGIYT
FHMGCLGKMKKQSFVDNCTNAIIEECLYLWYQNNYPHATLVNFLVKIFLEISHIWSRFDW
DGCLCTCHPNSHLNVQYSIAKDLCHKVCSDYKDILWCVCDGGGEEINLYKCRGSVKYGEY
EICFKDECMDGWTGDHCTERAIIIISFFCMLEIRVETEECRLKELCTSPTPEKCFIDKGG
MRICNCSKGYEYGDGDQICVDINECSRASKFCDQSTTYCENEPGGYRCECLLGFHRVDNK
MNTGPCYALLLNRIIFPLVFFVSAIFLVIFVAIVTGVYKVTGSLSVKPSSKYGN
Download sequence
Identical sequences T1EZ25
jgi|Helro1|167138 XP_009010899.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]