SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|167198 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|167198
Domain Number 1 Region: 192-318
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-18
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|167198
Sequence length 556
Sequence
MVIIVYIDKDTSDNNNLRNDDENNSEDDAYPKGGSITYRYRDLEPQFLTLKILFRGQTDE
RVVLTFTSFCMQTRNYNDNTDISGSSSSSSSSSSSSSSSRSSSGSRDSSSNSINDGTDLD
NDDEEDKEENDELLDCEEQNHVRILFSEEIGVRRELNIFCGCQANIPQSIMTRESNMELL
IVITATTTATSCTFEYRSSVSVNGSLTSPNYPGMYPPGMECNYLFRGSFDERVIIVFNDF
DIDGVSPRCTDSTQSDYIEFSSFNVLPDRKSSRLCGSRSKDDDVIIRPIQSEGGFFRVSF
RSNDDKYRGAGFEAVYRFERAHAKIISPRFSSESHSTSASAANNNYNYINYNINKLHNNN
NNNNKVQIKNKNLKRQHKNRNDISHICRSYINNNNINNNININNNINNINNNINNNNNGD
DSITSENDDDDDGNDEYLHNDKDDIIACYSNKSYSSVFAVDEKWTNTCCGNNNSNNNNNS
SSNNNNNICNFNNNINVCNISKNICKNSINCNIKDIYNNNNNNNNCCKQHNDNNKNSNFC
IYSESRNQSTFSNPHR
Download sequence
Identical sequences T1EZ48
XP_009010974.1.102002 jgi|Helro1|167198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]