SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|167270 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|167270
Domain Number - Region: 160-205
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0153
Family Merozoite surface protein 1 (MSP-1) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|167270
Sequence length 265
Sequence
MTNGLTITGNGSCTCGSKINYMVSYKSCRPNNNNKDGERNKSLTMFKRTYDVHAKTLAEA
TIVGCFKDFPTINRQHINNINTTNINNNNNNNNSGQNSKKNTLTMAEQFEACLNFCRLNN
FYYFSIKISECYCERDVDASKMVLISMCLADSRFYTVYTDCSKNNGDCGDNLKCERYQID
PLTPPLTQCLCENIWHPLYNGTHCFFMTSAVDYFASVVAIVSAIIAMLLLFSCMVACLSH
LCNRNRIKRTIEVADTLMEQEEEML
Download sequence
Identical sequences T1EZ74
XP_009011041.1.102002 jgi|Helro1|167270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]