SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|167294 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|167294
Domain Number 1 Region: 32-45,79-195
Classification Level Classification E-value
Superfamily vWA-like 1.31e-16
Family Integrin A (or I) domain 0.016
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|167294
Domain Number - Region: 698-760,812-840
Classification Level Classification E-value
Superfamily ARM repeat 0.0806
Family GUN4-associated domain 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|167294
Sequence length 859
Sequence
MNDKTYVLLELKPFQIPARNAFCQREHLPSFPLRLICLIDVSHSMAECYGDRDVPGDSIS
GSSSNLSGGPAATAASAAGFSKLDRIKIFGKLLAEVIGEENQVGVVVFGTNAEVLLPMCK
MTADAKQKMIAAFNGIALRGVTNISAGLFTAIEQFSKTFAKKTKYTNDNILLFSDGMPNE
GILDREDLKREIRKRIRRVQQECHYDPDYTIKISTAGTSGFFPESLYNLSRSFSSSPFHH
LGEESDLSSDLMLPILYMMETAIANVKVTITALNGVQFETLNTEDVIKTPVSKTDSSNSP
GSTFETVFSSTAWDEYRLVKRLKSKTPPKHKLESTRSNPLSPDSTDKSASPLFDPFPFFS
PHLHREYLVHDLAVDMERHILLPLLLPKKHKKLLKGKDVLSISITYRDSTTNNAKLQKVI
NFQDIPIKNENNDECSLLAVANCICRIMTCEALDRAAGLLEKLDRNSGVITLDTTMDTLK
RDCESLFKADSSNEDETLANVYKMLDPYLANLNRCKCYTADFSVRWDDVWSRLKSLRSSL
SLEILTSPVVYVDKSQLFLTENIEKKKKLIKRLLPKIKNEVLDSRRSSVADVDASVAVTY
SPVRMVSVSDTEQIYLKKKIVRRESCKKPLQTIQRTIESQLPPRLSKHRYSLQPPPTKQR
HQQQQQQQQQQFLFQQQQQHRHMIQSSQQSDVESTNSTLNQRQLSGKYTHQIIQQQPQQP
QQLQPLQLQQPQKLQQVRQQQNQQPSQQYQQKLPRSSQQLQQQYLQQQQTQQQQQIRPPN
NQQHYHKEQKQNPNTPNSKCSIKNQTDDKYRKSTTSNDAGDEGDDDDDDDDDGDDDDEDD
DAVATTDNNDDVTRLVTQV
Download sequence
Identical sequences T1EZ82
XP_009011064.1.102002 jgi|Helro1|167294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]