SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|167450 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|167450
Domain Number 1 Region: 50-226
Classification Level Classification E-value
Superfamily vWA-like 5.64e-26
Family Integrin A (or I) domain 0.0026
Further Details:      
 
Domain Number 2 Region: 243-442
Classification Level Classification E-value
Superfamily vWA-like 6.67e-20
Family Integrin A (or I) domain 0.0023
Further Details:      
 
Domain Number 3 Region: 481-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000156
Family EGF-type module 0.01
Further Details:      
 
Domain Number 4 Region: 2-28
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000954
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|167450
Sequence length 663
Sequence
MNNGLCSQACVDTYDSYYCTCDPGFDLEFIAMSTQQANCPRSAQLSTIASDVVFIVDSSY
NVCLSSVTCSLYTRELQFVNRIIDSLNVNNNQKTRVGLITYASNANNRFFLNAYSDITSL
KNGILNTGFQGTQGTNLAEAIRNARTNFFIEQNGDRGGVQNFIIILSNSFQAPSDVTSAA
NEVITAYQQGIITLAASVSQRVSDANLISLASYPLAPNPSYFKIPDPPTPFDSVAALMAN
QVLRSSALSTCDGKVYDIVFLIDGYQSNWNNFRTYLARFVRGLDIRSSASRVAVVIYTDQ
ARQAIGLNQYPDDKNGLLNAILNLQAPANFASSSNAVSAFDFARTQVFTNQNGDRSDVEN
IVIFYAFNQYTSSLLSLQTAALQIQKSSGAYVYAYTSTFSNLNKMDLKYVSSHPHLEYKQ
FGAMDWDSTSAFDNVVLSDLCKPYYDYFCRWTAGGGFQCFCPLNDCDTVPLNGTKCIDVN
ECSNNNGGCQQLCSNTFGSFSCSCSTGYRLSSDKMSCEDVNECLSAPCLGNTICVNSFGS
FYCLNRDSLSSGNAALEAPYQSGDPTSGAGGSGSTTAGMSNTSAVALTASISSVLASTLV
LILAFFSRMAYRRHKRQMRATKRGQMPSSMFENYGASMKDTSSLGSIRSRNFNADRDVDS
VDG
Download sequence
Identical sequences T1EZE2
jgi|Helro1|167450 XP_009011206.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]