SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|167668 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|167668
Domain Number 1 Region: 154-226
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000055
Family Spermadhesin, CUB domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|167668
Sequence length 232
Sequence
MLTRNSAEQQTSTKPHCIKIESFCLSTLHQRMKKQPTTIRHYETRHKRWLPTKKPHKHHQ
HKHNRIEHQTKSNQAEDEKKYNNDEDIDYAYKNANDSDELFLNNEDDDEQYLPYGHVDRT
EGLKDNTVCDWIIPVGECVGSCPVMSPSQVLLFNHSCTYLFISFEDFRIELKFPSVLLQL
SPSLNACQNASLVEIYDGYEASESLVEKFCVVKLDSDNETNGNTINFISKGS
Download sequence
Identical sequences T1EZN0
jgi|Helro1|167668 XP_009011663.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]