SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|167669 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|167669
Domain Number - Region: 97-163
Classification Level Classification E-value
Superfamily Replication terminator protein (Tus) 0.000157
Family Replication terminator protein (Tus) 0.01
Further Details:      
 
Domain Number - Region: 9-117
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00269
Family Spermadhesin, CUB domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|167669
Sequence length 174
Sequence
MADRVDGSECDWIFNSRQTSSGDFHTPDYYIPTSTKCRYIFVSETSNEGIDMQVVIQLNV
FYRQRSHENETCNESVSLTDGDLDVKNFCISEMVENVNQRYSYVYSAFNSVVTVTYSRRV
KQISNPEPTWVNYKFRRKHSLQNISNNTLVLSKKKTSTGENHATSHQNSLEVDV
Download sequence
Identical sequences T1EZN1
jgi|Helro1|167669 XP_009011664.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]