SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|167751 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|167751
Domain Number 1 Region: 142-189
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000275
Family Spermadhesin, CUB domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|167751
Sequence length 252
Sequence
MLSASNQYSRNVKTLEICVNYELPSLVYKFIRADIILSYRIYRRMELTSAVVTAIFLSGY
KSAVDSIGPRKTSTIVENKKYVISAGSFDRRSVQNARRLALIVPRETTNAQQYKTFTTSS
SNKSCCPCCYCEQMRIKYTPSKHQGTFYTPNFPDKYPQKINCLAYTFEGASTHLVEMTFL
EFDLPGPSSHSSTIIGRSMNPVTKNNKKPTTKRKTSERDSQNPHICIYSNGISDQSLGFK
FREYFNFSKDAN
Download sequence
Identical sequences T1EZR3
XP_009011740.1.102002 jgi|Helro1|167751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]