SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|167752 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|167752
Domain Number 1 Region: 52-110
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000379
Family Spermadhesin, CUB domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|167752
Sequence length 172
Sequence
MSDVLITDGYREITSLETVSGRTRQHSQFQMVGGVRKWNTPCHYEFYDLPKGLSSGKFFS
PRYPQNYPARTHCHYHFFATHPRVVKVLLQNIQLEAANGRHNENMNNLKVLPLLRWKSRD
GCHYEIGSILQYIKLNCMFRGGDIQVHMLADSDQAMQHIDWCEILKLPLQLS
Download sequence
Identical sequences T1EZR4
XP_009011741.1.102002 jgi|Helro1|167752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]