SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|167753 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|167753
Domain Number 1 Region: 17-78
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000379
Family Spermadhesin, CUB domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|167753
Sequence length 228
Sequence
MSNFFPNFGNTEAYFQSEYCSSSPDRLVARDGSDATSPIINIYCGILNSQTITSSSTHLY
LELITDELNHKQGFAALYNFVPQMSVDVRTDDVGLSKNVINHGSFMNANANVHITESFRK
PHDSDDNHYHHLRDNNNNSSSSSNNNNNLLHDNKQQSYVNRNNRHSLELQQQQQNLKHDF
SISTSPAKKLASWQNLNNSSLNCHHVLHAAASTWPQKYSHNQEISINI
Download sequence
Identical sequences T1EZR5
jgi|Helro1|167753 XP_009011742.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]