SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|167764 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|167764
Domain Number - Region: 351-410
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 0.000989
Family YdcK-like 0.035
Further Details:      
 
Domain Number - Region: 208-248
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0294
Family Pentapeptide repeats 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|167764
Sequence length 486
Sequence
MCETMISDLENKQISKKIGPERSEEIENQAETLNSIKENVNELEQFTIYQKATTRCGTFV
QQLKSCSKRTDLNNVINKARSKLAVDNRNKCESNSVKTKLNKCEPNKIIDVDDITMVSRK
KKIYTVAKLYIGFSETQGLENFDSEKIFSKQAGKHLKERQAPMTIRPRPYNDQVKNYLYA
ELVLTTKYIFYVGKAFNIDHRITLCEFCVDNRNIGNCNIDSCNIDHYNINNCKIDSCNID
SCKIDNNNRYNNVNYYYDFCNYYNHTKAQTHKLIGQHKFIQKSCRSFEVVVTMHLQDDIL
NDHTVLHKKHSHRRQSARLLDNGSYDNAEQRLAKILDILHYWTISGQINIKPIQKHKNIT
LEDISMLDDTTMLDDATISDDTIMLDDTTILDDTTMFDDTTMLDNTLMLNDIMLDITKLG
TDSLDVSKMLYDTIMLRDVMELDGYIDSDDIIKLKTHVQTHAQTAQHTDRRKCRCGHKHG
TCVRGI
Download sequence
Identical sequences T1EZS0
XP_009011751.1.102002 jgi|Helro1|167764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]