SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|167766 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|167766
Domain Number 1 Region: 1208-1244
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000714
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|167766
Domain Number - Region: 984-1009
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00113
Family EGF-type module 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|167766
Sequence length 1287
Sequence
MMKPRLWMLLLLLLLLVTMMMFLLALLLMGKELLFLHAAHVRPPSVIDCNESFLINCIVR
RASHIHTHNHLNTIRKKYNNAEHKKTFNNTNSINKTKMTTKNINGPNNNNNANNIKINME
NFGRSGSFVNDSNGDVNAIDNLYDDYNESNNLLERANFHLKNMKNNADKYAFMSNLMNPF
FPINFKTQKIEDDFVKKNVNNMRLSSKMDNFFNITKHKRKPLKSVQGTNNAENINNINNN
NIAENINYNINSINSYSNVNIINSTNYVNNKNSANTIKNHNKLNSSEEDIIIIIGGRNKN
DIVGTSASRGRSRRNKNIFEMYNKKESKHDGNKIGSYNNKNHQIRVNVANRRVNEEKNFV
NLYYKQLTNINNNLDNNNNIGNINKDTNNKNFAIKMNKKNENISRNPNQLTDVRKINHAI
NLGDKESNGSQSQSHNAMNFQIGSIERKFLLNFVNDDNIKKCCRNNYQQGDNDHAHSYTN
NRERKCQKISCYFFNSNFINTLISNGSSNISTNVNNGKSYSGYDSNNRRGGRVSRKISSR
SSRSVSSNSSISNSSSSSSSSSSSSSSSSSSSSIASKIICRQAECISEKQSKYFCALKKN
LIVEITCIIDNNNTQNNHDCHVAESKYIVIDGEDSNSSVTKVNYDNDRGDEDEDDSNNNN
NNNNNNNSNNNSDSKKNINDNSGEKYNLNFEVLKAIYNYLHANRSNDSDRAYAFKKNGEN
NNNITNNTNTNSNDSINDNNDTKNSPKVANRFKIIKNRHRNVTNMNDYKNTSYFLITDET
KNYFGPNKTFLERRNLSNNSKNNYLECVYNRNIKDRDIIKYTNEIEYVYENLNKSPVNVD
NNMKRSLSTQDNNNDIKNSSSNNTNNNHKDNSIINDTKNINNFDEYQSDEPACVCYNGGT
CFAENINSVVSNINTVDNNINNNINTNTHYNNFNQHDNIKPKTNNQIHHQISKTHKVIQQ
NNANNNINNDDDDDNNNLDYKPDSHKPQKYRCICIHGFTGHQCERPVMRRRRLDRPSCLH
RPCYNNGLCVPMETNSTSTTTTSTTTSAAAGTLLTTNISAKQASKTSNSGKSQMKAHWLN
AKSEKWFKDDDGVNKTNTTKNIDANVYQNKIINKTYNYIYNNIKSINNNKNIKKNMYNEK
VDYTSSRNNALINSGNELHRSSDDIFPNHHHPQRHHYYHQSQQLQQPQFVCKCSESYQGV
FCEEELPCNGKDKKCYNDGECVVLDDNIFRCNCSEGYSGAKCEDFNPCLLPDTCNQKGVC
QPALFCSGPLFKLTYKQDNYIDVENQL
Download sequence
Identical sequences T1EZS2
XP_009011753.1.102002 jgi|Helro1|167766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]