SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|167767 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|167767
Domain Number 1 Region: 21-46
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000473
Family EGF-type module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|167767
Sequence length 119
Sequence
MPGIILFKRGCLSVSVNKIKDKSTFSYLCICHVGFHGQHCEHFQPCSTSNFLCHNGGTCV
HVNRSSSSSESSSSTNNINPSGRISSSLKDAGSAIGDFRNSNGDDGHMDVCYCMAGYGG
Download sequence
Identical sequences T1EZS3
jgi|Helro1|167767 XP_009011754.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]