SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|167974 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|167974
Domain Number 1 Region: 58-167
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-30
Family Spermadhesin, CUB domain 0.00076
Further Details:      
 
Domain Number 2 Region: 277-390
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-26
Family Spermadhesin, CUB domain 0.00062
Further Details:      
 
Domain Number 3 Region: 396-502
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-21
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 4 Region: 504-607
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.2e-21
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 5 Region: 641-742
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.07e-16
Family Spermadhesin, CUB domain 0.0022
Further Details:      
 
Domain Number 6 Region: 1057-1095,1169-1244
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.42e-16
Family Spermadhesin, CUB domain 0.0077
Further Details:      
 
Domain Number 7 Region: 951-1053
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000017
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 
Domain Number 8 Region: 882-952
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000157
Family Spermadhesin, CUB domain 0.0028
Further Details:      
 
Domain Number 9 Region: 1270-1372
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000183
Family Spermadhesin, CUB domain 0.0038
Further Details:      
 
Domain Number 10 Region: 739-858
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000183
Family Spermadhesin, CUB domain 0.0076
Further Details:      
 
Domain Number 11 Region: 168-280
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000432
Family Spermadhesin, CUB domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|167974
Sequence length 1407
Sequence
MVIILKSPPYPMEWHERTSSPASFQLYYESVGSHQTSEMRVQYLFNIIFNLGCIGFYQSE
TGNLSTPSYPVYYKNNLDCQWFISVTNGKRILLTIIDIHMEQEGECKYDYLQILNGGELD
GPEIANLCHIQNTSQAITSSGNSLVVRFKSDESNSGKGFYANWSTVDEGCGGDFSAKKAD
LGTIDLTNQRNIECLWSISVSKGSLVNLTFNDVDLGPRLSCSQNNLKISTTSDFSQSTVT
LCSIVSKESRLFESDRIWMKLKYRQGGRIFKVSYETGCGGTVNVDEPGELASPGWPNTYD
SNLNCRWILKSSFLDAKISIVFTHVDLENEPCVHDFIRVHNSWQRWNESLLQQICGVNLP
PMITSDSNVLAVTFVTDASSEGRGFTLNYFSSLSACGGNLTSHRGFVNSPQYPSNYPTKA
ECVWYITALDESLIELSFNDLQLDVVDEKCSGDRIEVVADGLPTILCRPDSLPITSHKSM
TIRFLSNSNRTAKGFSAQYKFIHGGDVRQYSGKIFSPNYPLLYFTYMDVVWKIYAPPLFY
IHIWFSSFELEARDNYNDQCYDYLQLNDGPKACATTPPEFTNDTNEVTVRFFSDRSNVYK
GFVLNYKREYASPDKIQIGQYNNDSLCERSVLIESFKESITITSPNYPNPYNKNSLCIWT
IVSKVGFIRLNFDYINVELNKDLIQIYSVKRTGKELVMSMCSSRDCLKRKQVYVSSDKAE
IRFQTDNDIELDGFYMTASATCGGLYSRERDTIIHPADDQVQSDECLWYISVPQTSGLNL
QFHYFNVGAKMTNCSSSSRLEIYRELDVHYTVPDMFCGDNAIVSYLGTNQLVIRLVQING
NITESKFKLTYHPMSLACGRHETIYPENPTYNIAWSSLNQPDSTLDCIWVLTSKNFSTIV
LNFNSEFHVPSSSNSTCDTDFIEVRDGPSESSTVLIKSCGDSIPPPLVTTENSPCGSVFR
DNFHAISSPNYLNVSCQWKIILSEDRFIKISAEFVNNSYDERVILKEGAANGSIFGEYHE
GKNDVFVSSSNVVFVQFTSHSNVTSNFKLLYSSEKQSCGGTLEMEKGVFTSPGYPQGTNR
AVMCKWQIIAPEALFIPHLISTLHSTSDQHSSFHTKDNFSSDANRVTLYTKSYSKIFVVK
YKSPTGFVGSLNDQKEKCKLHSQNKSKSILLNITDFHLTPLLYSMGFDQYMQVFNGLYAD
SPIFYRGHFLDNNIFRSSSNTMTVVFKSVFKISGRGFKAFYTTYDDSVCHLGHNKVLGNI
VTRRLDGSLGYEKQTECSWIIYNSIDSSNSSMTFQFNTLSIERDGECTMDYVQFHEGTRP
TDLSIGKFCSMDQLDKDLPAISSASRSVLIRFHQTFYNNFQVGLNITYRSYPCGGIITRS
TTITTPLTMGWDCLWHVKADRENVIKV
Download sequence
Identical sequences T1F009
jgi|Helro1|167974 XP_009011929.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]