SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|167978 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|167978
Domain Number 1 Region: 18-91
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000534
Family Laminin G-like module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|167978
Sequence length 106
Sequence
METMYNNRDDVNGDGDDVKYTLDEQGGKLEIDRILDQESMGATGRDYHMGPCSSFNSLVF
GGLSHKIYNNHKIVKHRFSGCIRKLNIDGKHPIIPPKYFAVSTCEE
Download sequence
Identical sequences T1F010
XP_009011934.1.102002 jgi|Helro1|167978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]