SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|167979 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|167979
Domain Number - Region: 24-62
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0257
Family Laminin G-like module 0.033
Further Details:      
 
Domain Number - Region: 57-90
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0942
Family Growth factor receptor domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|167979
Sequence length 166
Sequence
MASEWQLLTRQNNIYFRETINICADLVSMYLIEGYVVFARRCVYGLAFEVHSNRTWNDGH
WHNRNHDGHCFHCPHTVYCYHNHTNTQCKTMQYNTTHATRRKEIKRIAFQFNTAIYGVAN
SDVSSENTGVGDTEIFEVITLVSVVTIVQSLQQCNLSHEISNAYVI
Download sequence
Identical sequences T1F011
XP_009011935.1.102002 jgi|Helro1|167979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]