SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|168030 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|168030
Domain Number 1 Region: 154-289
Classification Level Classification E-value
Superfamily Integrin domains 2.04e-31
Family Integrin domains 0.00055
Further Details:      
 
Domain Number 2 Region: 299-447
Classification Level Classification E-value
Superfamily Integrin domains 1.31e-16
Family Integrin domains 0.0027
Further Details:      
 
Domain Number 3 Region: 84-152
Classification Level Classification E-value
Superfamily Integrin domains 0.00000000523
Family Integrin domains 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|168030
Sequence length 527
Sequence
MSTPAQEPQKRKRLNSFAQAIYRLARCSLLDFHLTWNLDSSSTTDNKRIDYLERRTINNS
SSSDYENIEYENYIVKTGTNSPLTLHINERKCLSLLLFLKDKIRDKLNPISIFLDYNLAD
SQLQKNGTYPDAILNIFAPSVYILVPIQNNCGADMICIPDLKLNVSSISDHFILGSLEEL
EIVINIFNDGEDAHESVLFLELPPGASYVNIKHINEKSLDVSCCLVSNNNIQLITCDVGN
PLLQNDSVSFVVRISSYNVNFQTRELIFKLFVNSSNNEMPTPSFSNEYELLIKAKSVIDV
EIRGVSLPQQIFCNDTRMTSEIDKESFEGSLVTHLYEIINLGPGHIDKLFVSVNWSGESS
KVMFLFLNDSSVLPGKVFCKICDGAREKCEIICVIHNLTNKESVLIRIEAKIYINLNEQD
YFDQYSAFSSEARVLKLQVPYNVTPVFKSKLFKITTKVFMPITSYIRREFWKFVIGILVG
CSLLTIAMLILYEKGFFKRKKIDDEDYEDIRPHKTYKEIKTADVDYY
Download sequence
Identical sequences T1F029
XP_009011975.1.102002 jgi|Helro1|168030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]