SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|168373 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|168373
Domain Number - Region: 158-195
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00484
Family Spermadhesin, CUB domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|168373
Sequence length 483
Sequence
METVNITCSHRTASSSSSSSSSSYSSSSSSSFSLSKPLKSVVLMTLAKYGRMELGKCVQR
NLGFLGCFDDVTKVLDERCSGREKCIFKLPDPIMFTFQTCPHDVTPYLHVEYSCLPVEDD
GNICQSQTVKSTLQSQYISSEILTSEIDKKDNRRVNTNLNNFVSSSSNCAFIIEASPGQQ
INLTILNFFSNQYISKNNNYNGANKNIISGNNHRINSSTARADDKVDIFHYQPDAPKTSS
IARRHEPLTPRDDNYDEKEVGFYRNDSSVFKNLQQIVKTNSINLSVFNTSTKFLQIKKRD
LSELFNPSKTFKIAPNRQTPVPSNHPNSPLHLAQVASSPTLTRERFPPHHSPYQQSYFQH
SQQLCIVLGYAIEIVPDTHNNNNHNNVYEKNNNLKVKRNVNYTSSELTNKSQLRNKHDEN
VKKFQANVERSQQPERQKEITFRREEKTFLCSASTKRFFLAPSGRRHIHTSLEYPLKIPR
STT
Download sequence
Identical sequences T1F0I0
jgi|Helro1|168373 XP_009012484.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]