SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|168638 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|168638
Domain Number - Region: 50-84
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000156
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|168638
Sequence length 114
Sequence
MNVLSSLYETAGITMEAVLKIYFVGGMRFRKIISANAFVRSACITTGLDAMVTNIDECKY
TSVCQEMHCGCVNKVGYFKCVCTSVKHYLKHMLTAIIIFETVIIVPQIILNFFS
Download sequence
Identical sequences T1F0T9
jgi|Helro1|168638 XP_009012747.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]