SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|168899 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|168899
Domain Number 1 Region: 205-242,389-468
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.81e-17
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 2 Region: 440-547
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000212
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 3 Region: 847-968
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000691
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 4 Region: 653-773
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000889
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 5 Region: 50-167
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000113
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 6 Region: 511-624
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000353
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 7 Region: 942-1054
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000212
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 8 Region: 1018-1126
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000102
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 9 Region: 620-657
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000605
Family EGF-type module 0.0058
Further Details:      
 
Domain Number 10 Region: 776-814
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000151
Family EGF-type module 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|168899
Sequence length 1136
Sequence
MKRFNFLIICFCFVHLASHEVCQYPSGRPKCNCPVGSCSLVNNNSESNDYKCIVGCSAAT
CIHGTCSAVGSNYKCACATGFKGSNCGADIDECAIGNNPCKNGGVCVNTVGSYTCQCKSG
FTGANCASDIDECETGNACLNGGKCINTIGSFNCQCKRGYTGSTCASVSPATVELDTLAP
IVDRVICFFIATFIDLMALEDENECEDDKRCVNSDSCRNTDGGYFCACAPGYTGPNCTTE
FNDFWHEVTLKAAKNNKVAPSLACVRRASQKWTKEYFKRFYIQAVDPELECLKTRFKVEG
FLIAQNVKKSDLSALNLQDQDVKVSKLLEYYGNDTNEDRLTLHLKMPDAFFDITCNNLHN
REKFLGLKQSKNVSAIHNGTGEAEPHIDECSAGTPCLHASTCQNTVGSYTCQCKPGYTIG
SNCAADINECLSNPCRNGGSCVNTDGSYFCQCTSGYVGTNCESDINECAVANPCLHNGQC
NNIPGSYVCTCPTGYEGTNCETDTNECLQTQVCKNGGVCFNTVGSFNCQCDAGYTGTYCE
RDVDECATAGRCLNGGTCNNLFGRYECHCANGFVGNNCEQDLDECTDSHPCVHAVLCQNT
IGSYICHCVDGYNETNCNTDVNECEVSNFCENGGSCTNSVGSFRCQCQAGYEGSTCASDL
NECQAGSQCNGRGTCFNTFGSYVCNCAAGYNGANCESDINECKIGSPCLEGGTCENTIGS
YKCVCASGFAGGNCESDVDECLDVNLCKNGAKCVNKVGGFDCQCASGYEGKLCNSDIDEC
NPVNPCLHGGFCQDTDGSYKCFCADAYTGVNCLDDLEINLKPIIQQNYKIQIFDFSNYSC
PKKTRNVNFTDVNECSDLSLCQNNATCVNTVGSYRCDCSPGFQGSNCNTDIDECIIGSPC
NDRGICLNTFGSYLCQCDVGYDGNNCELGCDDVDECQDVNLCKNGATCLNTVGSFNCKCT
ANFEGALCATDVNECEDDPIPCFHDGLCQNSYGSYECHCAAGYNGGNCEADINECLDEST
CIHAVSCDNTDGGYTCHCLSGFRGKNCQTDIDECAELFPCQNNGNCQNTNGSYICHCSSR
FTGFNCQTDVNECEVGAPCKNAGTCNNVYGGFDCDCSVGYQGTTCESGAVIHIIGD
Download sequence
Identical sequences T1F141
jgi|Helro1|168899 XP_009012995.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]