SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|169094 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|169094
Domain Number 1 Region: 30-48,146-316
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.8e-28
Family Laminin G-like module 0.00068
Further Details:      
 
Domain Number 2 Region: 67-135
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000943
Family Ovomucoid domain III-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|169094
Sequence length 327
Sequence
MIPLKNMLKACNCSTFGSLRTDCEQSTGKCLCKPGYSGPQCQICPNGEHVASYGYHVKKN
GKRCVNDLNCKYGGKCKKVGQNIECVCPASCVESSVSSLSAVCASNGLTYSSECHLAQFS
CRSQVDITLQHYGPCVNNSDAGGSVGFDGTYYLKYVSKLMDDEERKLSSIQIEFSTDSPN
GVIFFEGESFSPASSFILIGIRRSKLVVMFNLGSNRADDLPLMTSSSDVSDQQWHLLTLR
RDERQMKMVLDFDEPIVAYSRPGANSFHSSGFFYLGGAEKRMKGLPRSLSAALKGCLRNV
QINKNVINLREDRINVDTELKKCHDAL
Download sequence
Identical sequences T1F1D9
XP_009013172.1.102002 jgi|Helro1|169094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]