SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|169345 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|169345
Domain Number 1 Region: 377-474
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000101
Family Spermadhesin, CUB domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|169345
Sequence length 515
Sequence
MANKIGSSYSRYDQLSRRQQQQLNNQHEHNHLQQQSQLYGYYHRQREHQQNQHSSTSAIS
ATSTTATSTTATIYVCSRHTLNIHCPHNDDQLVFISATLGLNNSEVAIYCGVKYNFNCDT
DIHFRLNGLCSGNSFCQLPVSEKLFGNACGLHEFMLLQYRCFQKKEIINICHGEQLLKSS
TSSSSSLSSSSSSSPSISSSSSLTSPPYLELSKNSYFILTTKPDLKSIMGETETFRSSLS
SSSSSFFSSSVSSFLLESPSSSSSSNLLLPQPFQSSSSSSSSLASSPQRKHRDVKTTSDH
KNENFRSSTKLSTNHISHNPNHLNNNINNNLNNNNHNHNNNHKNNNHNNNNHNNKSSRSN
SNKNILNLNNDNILAAIISPNYPSKYTRDSHCTRTISLNPWQYIQITVPDFELDVKRSGK
CFDVVEVRTSKDVLFSECGPLGKQIVLVPDFRAEVTMVTAETTMASRGFVMFYEGVSLHK
FHSSSFFVRQPFLSHFPILWYLIIMHLTSLARVGR
Download sequence
Identical sequences T1F1T2
XP_009013419.1.102002 jgi|Helro1|169345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]