SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|169404 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|169404
Domain Number - Region: 97-138
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0133
Family Spermadhesin, CUB domain 0.0096
Further Details:      
 
Domain Number - Region: 285-327
Classification Level Classification E-value
Superfamily DNA-binding C-terminal domain of the transcription factor MotA 0.0902
Family DNA-binding C-terminal domain of the transcription factor MotA 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|169404
Sequence length 349
Sequence
MRSNDCISSKYGHVGCWVDVTSHLNGLCGGRTSCQVLVISLYQLLVDCPRDFKAFLDATF
QCLQVIRPVNNQCSHLPNNNIVDNNTDKYLLLSNSTTSGYLSNLVSRDANAKKNCHWFIW
LQHDYQRINLTFIIFNITSNNKNDDEDSFSSNSNFMYHSHNSPTTKSRYKTYVIKSFNNK
IEDNLITNNNNNNINNDINNVIYNSNRNSHNNHNSHSYNNHNDDDGAGEISCIPLASLAE
IRMVIEGMKASAVKEKMRYVCVEERWRDKEDEKREGGGGFNFVSRYGISGVEIKMFDDHN
KNINDVKSANHYADINNNSNNINNNINFLQLKMAYYLIKIEGSYGNFLV
Download sequence
Identical sequences T1F1W5
jgi|Helro1|169404 XP_009013467.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]