SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|169458 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|169458
Domain Number 1 Region: 154-209
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000184
Family RING finger domain, C3HC4 0.0085
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|169458
Domain Number - Region: 243-276
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.000458
Family Pentapeptide repeats 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|169458
Sequence length 329
Sequence
MDHSTEYDYFWSDAKLAANTYFKKFIEEKHQSMSCTYESYLTEHLTENEFCLEDIKEFAA
AVSEDLLNLACSQVIIKNDDEPKSVTSPCCYLPIEKRSTLMKEMQKLFISRLPRENMVYE
CPYEGTHTKGSIRHTDNYFKADCNINILKNSYLEQLSINDSCPICIEEYEEGGNICQISC
GHSLHFGCAAEWIGKRPVCPLCLKQVRTVMSTSIKLEYKGGNTVDVNITTDHFVGNNLEL
LIDNDFNESDFNEADSSDDDLSETDISEADISEADFSEDDDVNDANNYVRDDDDDNIADI
ATTIMTMSLLVGTIFLFIFDLNSLRLYFL
Download sequence
Identical sequences T1F1Y8
jgi|Helro1|169458 XP_009013514.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]