SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|169786 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|169786
Domain Number 1 Region: 992-1150
Classification Level Classification E-value
Superfamily vWA-like 0.0000000000000223
Family Integrin A (or I) domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|169786
Sequence length 1214
Sequence
MFDFDDSMLSNNLEGRDYSTRNSTQRKPVQKGKPQPLTIFNETDLGKQTKASKKPQGTEQ
KSHRHEKTPHDDRLAFTTGRHNDNHHARNNNSSRSNEKHNVKFKNTNNNNKNKYYSKNNN
YNSNNNNKKKDWINNWNAADVGNSYVDKRELVTHVNQTNDLADMSDDLKNLCKKYRTMED
WMRIHSLSYLKLDMKHLLSLAKFKRPKMSKTTGKLQQCMEFQRSDVDSFHSRLQAAIEEY
SVKIKEYFKGTKRYFGDVRGDRVAVVLDCSEDNFVHNRRMLYISALKRIICIAPFLTASS
FPTATTATATTTAACAATVATYKATSIATDTTAKQLVQEQLSNRRSLFLAAYNSRYYKLW
SSPEFISQTKPECGLQMICDYVERRLLSLNVCVHFVSFECYDEATNELMRRFASDTGGVY
HCFNKRFEQKLNYTSSELELLLKEVKKCQQVLLSIYNIRTGMLGTAIVKIIEEISQELSQ
YPFNQSLPSNHFQPLQLEPITFKQDTSHDWLLRNGLKAKNLDIYQVLSRNAFSYRQQFVH
VTGKTVQSLVNERAMVQFHWSDGSIKNVHVNFLELQKYQGQLGEMVGLLEKRVEWLEKGS
RRLFGSVTEEKCSLEIKMWRKTLVEPNGDQLQLAWKWIQSLKCSGSRNTLSGVMMVIEND
EMTKFPLGLYLMTTGAPDQSRDLVTSYLEEHCLDGDVKLHVIYTSVDDYEPAIKRLDLSP
YPNTGGYRAITNGTPILNDVMIFDPNSPLVPPANLTDFYDNLRFTDQLNQIAFNKHANLI
ADQETGSERPRYMSRNVSYINPSIAPLDTLFTIIIVVILTLQLKQNSNQSDIIESDDVTL
LRDEMEKAKEHSRKCTQLVEAVRSKNRLLHEENRSLLSLKQTILSAARQNHINEKEKIKR
RVTKNLAYMGGSKFRPSSAPQESYGRVRGENNPSDYDEKDTNVYRHILLKNDQLIIIENE
VKVLIKKYLLRLKWLYTGSRRYFGQILEDSCIIIIDTSGSMVDHVTEVKSALKLLLDEQI
AHVCKLFNILTFSNEVRAWKLRMTGVNEETLRQAREWVDENLNAHGNTCTLHALQIAFKM
SEASSIYLLTDGRPDTTMSLIGQEVGQMNINKGSNNRVKVNTISFNCNDEQANSFLKKLA
HENGGRYMRLSPGRNVSLLLDTMVTRGFSDYQLSTLGAEEGDDVEEVCKEVSKLSTILND
IHNYKQLNNEWNMT
Download sequence
Identical sequences T1F2B6
XP_009013852.1.102002 jgi|Helro1|169786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]