SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|170112 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|170112
Domain Number - Region: 59-117
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0035
Family Laminin G-like module 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|170112
Sequence length 139
Sequence
MKKIYKLKLFEIVESLGAIHHGAVTSDFMTIAIMIIFIFFLSSQRLVADEMISDANNINN
NNINNSINNNINNNININSNINNNNKWVTIMFEQRQNRVSLLVDGKKKVQEKQDVNRTFV
IAETATFTCTTYTHKPDFT
Download sequence
Identical sequences T1F2N1
XP_009014177.1.102002 jgi|Helro1|170112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]