SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|170113 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|170113
Domain Number - Region: 257-308
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0732
Family Laminin G-like module 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|170113
Sequence length 362
Sequence
MCSRNIFYFIFNKYLIVACENFQILKKYSDEELGNSCYIKTLTLLFDGTKHSTLVYYLYS
SSQQHQQLQQRRHNYQHQHINQQPFHFPSYGTFQPHENLKPHFDHHHLLRKLNHGLSKNN
EDFDVQHFISDQTHSYNNFNNNHHNNNNNNNNNIHNFQNHKKNNVNKHEGSNISSATNKS
PNKINNIHESHHATNVLSNNRTINVAADPQFNYFTYNHNLLYSNKVSQVNNYLNNFYPPL
QNKNVNHYYNLKPPPLPRPRLYFSIFLRVRTTLSDCHIMHVYKSNVQHVYSLSLIQKKFQ
LEITKRSKLMLCNSYASHLYMDHCLAIGAEKAKYLIECGMKMLLTSLLFLQTVSNINVKK
IF
Download sequence
Identical sequences T1F2N2
jgi|Helro1|170113 XP_009014178.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]