SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|170114 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|170114
Domain Number 1 Region: 61-165
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000699
Family Laminin G-like module 0.015
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|170114
Domain Number - Region: 210-241
Classification Level Classification E-value
Superfamily ARM repeat 0.046
Family GUN4-associated domain 0.076
Further Details:      
 
Domain Number - Region: 192-210
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0678
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|170114
Sequence length 291
Sequence
MNKVCSIMDTPRALLYLTIPLNDKNNCVTRASTQQQLFKQQQKATIGNKCITAEQCAPDA
NGFLCLLMDLGSGTLKIQSSSHPINDGQPHYFALNIHGNRGFVQVDHYHRPFALAGPIRE
TLDLVGGLCWGELRTSKQPPPHLSSEKSFRGSISNLILNFQPVVITAHILTSQDTFGVFL
LNEKSEDEAASGCQKNNPCLNGGRCINGHHDDDDDSDDKDDDDDDDDDDRATFNARNADD
DSDGGGESNGIYVRCDCSYTEFTGKHCEREVFLGTQKDKQQTLLACSDESS
Download sequence
Identical sequences T1F2N3
jgi|Helro1|170114 XP_009014179.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]