SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|170571 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|170571
Domain Number 1 Region: 175-216
Classification Level Classification E-value
Superfamily vWA-like 0.0000000208
Family Integrin A (or I) domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|170571
Sequence length 222
Sequence
MALQDYLMLDPKVTKIDGSRLLEEMNEKMSSMLAKKVKSVSDLVGLAERFFSEYQYDNEI
KMKYYNSKLLNLSEFELRVGERFKNIAINLQHSTIHVPTNVYNESAVILNGVSWTDQLNT
AFVNNFRIDPTATWQYFCSSSGFLRFYPGTKWETLNIDTFDCRVRDWYLQAAAYPKDLII
LLDVSGSMRGLRNQIAKATVHKILDTLNDDDFFNIIKPYSKT
Download sequence
Identical sequences T1F369
jgi|Helro1|170571 XP_009014625.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]