SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|170722 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|170722
Domain Number 1 Region: 350-575
Classification Level Classification E-value
Superfamily YWTD domain 1.29e-37
Family YWTD domain 0.00000765
Further Details:      
 
Domain Number 2 Region: 30-284
Classification Level Classification E-value
Superfamily YWTD domain 5.75e-26
Family YWTD domain 0.00024
Further Details:      
 
Domain Number 3 Region: 656-911
Classification Level Classification E-value
Superfamily YWTD domain 4.97e-18
Family YWTD domain 0.00099
Further Details:      
 
Domain Number 4 Region: 1197-1371
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-16
Family YWTD domain 0.00071
Further Details:      
 
Domain Number 5 Region: 1471-1510
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000124
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 6 Region: 301-345
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000396
Family EGF-type module 0.007
Further Details:      
 
Domain Number 7 Region: 1529-1564
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000812
Family LDL receptor-like module 0.0014
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|170722
Domain Number - Region: 608-658
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000549
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 1017-1049
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00168
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 1447-1486
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0647
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|170722
Sequence length 1959
Sequence
MSCIFVLFLCLPQIILVFFPTAGYVDGTLLVYSTFKSICLVDVSEDRRADDKSQVLFRDG
YTISTVDYLRDENTIFWMDSDENSVLKLESYNATHEIKTSLASLHDSVLMDMSIDWVGLK
MYWLDQDGRIEIRDLFEFDRAVVVFNNLIQPGSLVLYPEKRLMFWSTCGDVPYIESASMD
GRDRKIVLSLNECISWPSGLTIDYENDMLYFVIEASRRVYKCNLDGSNLSLVSPNNVNNN
MNPLSISIHNGMMYWIELTNSTIIRCKLPQCSDPRILANTLFPPQDVKVVRPERKNMNVE
NPCSKNNGGCSYICLLSAVTSQQYTCACPAGVVLKKDGRNCEDGPSSILLFVRYTNLQWV
SLDTPDYIHVPIPIDSIKKAISIDYDPIQGMIYWSDFNRSSIGRALLNGSTNMYTEVETV
IQVPGMNPEGIAVDQLGRNIFWVDSGQKKIIVAKMDGSYYRKDLITTELYNPRAIVVDSK
RGNLYWSDWGTHPKIETSQMDSSSRQILVTSNLSWPNGLAHDGVANRLYWGDAKLHRIEY
IDLKTKRRVLLVEGDYLYWSDLTDRVIQRIHKSEPANQSQTIIENISDLMSLKATYLEST
SDPDAGDDVCMKKNGGCSHFCFLSPLPTHQRPVCFCPDGFEMAPGDNQTCFSTQSFVVFS
TKGDFGRVTMETGNVAAMATTKSGYGVVVGFDVDVRGSGGGGGDGGVLYWGDEASNSIRR
KEFSGPQQQESFISNVNPGAIVIDSIHSTLYWTDVGKNCIEMITLKGRGYRKVVLWKDVT
PTLLAVDPLNGYLFWLNRGAKLNHWSIERSSLIGSFRTKMVANNDDNNKNNNKRGVGDSE
EDGGVTSIAVQPSKKLLYWLRNGTLYWKHYDRSTIDTYERKDSKFTLVSILSDSLLLYDP
SSAEVYQFNLSDHSIGDGLFGNLVKKYQLRLNNNNNNNNNKNYYNNNNNNNNNRDDGHDV
IGLSLVDFSIRPNISHPCKESNGGCSHICLTNSNYNNINDDYKITNINNNNNNNNNNNNN
NNKYICSCPTHYRLLKDGHTCQGPTSFIIASQKNSFLQILVNAMNKSGNTNGKNNKSNNN
DGDDDDDFVTSLPDLGINNFRSLTYDPFKGHLIWVDSQGSTIKSTYYPISGSSYFGSSGS
NNSSGNNGRVRGSKNVGRSRGSSNNRGVFGVHLNVNNEVPHPTVTIVSSSSPSSSSSSSA
YIFDLTIDYNSRLIYFSNLSCSCVQAVRFDGRMVGTVIKEGSPRYLVMASKAGYLFWTNK
GKRLERSSLDGSLKMTILNTGLGQLGPIEVDDYSTPTSYKSGRVYWIDVELKRIESSNLD
GGDRRVIVHDTGREQATGLAIANDLLLWATKSGSIEKVSSANGAGREVVYKKSGSPITSL
LFSKYKSNIMPIFKATQQLDASDKVSYQHGDDVYNKYGFCPTETCTDICLVEYENTLSMD
SEDVDEAKWRCSCPFGMQLGDDASTCTASTPCKMNQFQCRTHLFCIPREYVCDDHADCDD
HSDEADCPKTPRRQSTHASNVHPEFCTEPENVWCPGGDACISREFLCDGKYDCVDGLDES
NCPNDGNSSFLLANGYAIGIGVVAAFVVGLTLILLLFFICRQKSRKLATAYPDDVVMVAR
PNAPPSTASFSAPDSNSLLLKSTDISVDGSQVFAEVNSDDCEVRNDDDVGDDFPHRKLGN
GHHLPNKRLKHQQPTYSRRNKDTMTSSIAGVFYGDDVTEICSGVHPDSLYYDRGHITGAS
STTGSVMTARPAFDPPPSPITDRSTIADVEEPAVPRPQLHHARRHQNSGRVLPENLYPNP
HFDSSATNPWGKNPGKRKKLRHKRHRRYVPTPCSSTADELMVMTHFDEFQPNLAPPPTPL
SDYIQSRNSLFSPDVSCPPSPFTGRSNYPPPPPSSYFNEEEEEHGYDDDDDVISDNDDDD
GFAGGNINNGGALVNVLSSLGHGSHNDAKNGIIKKKDCV
Download sequence
Identical sequences T1F3D0
jgi|Helro1|170722 XP_009014764.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]