SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|170808 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|170808
Domain Number 1 Region: 81-138
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000523
Family TSP-1 type 1 repeat 0.00033
Further Details:      
 
Domain Number 2 Region: 38-79
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000125
Family EGF-type module 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|170808
Sequence length 177
Sequence
MCSYKCAFVNNIDTCLCPVGFEMTTTSCVVLISNFSTDINECKTMTPNPCDPNHGICINI
VGSYICVCDDGYMLGPNNTCNDRNGNWATWGGWSNCSQMCNGGIAYRSRYCSSPSPQGLG
RNCIGNATGEQQCNTQDCPLTKDEEVYGRTIYVRGLEYDLVRYVCILTTFISSEVKC
Download sequence
Identical sequences T1F3G5
XP_009014885.1.102002 jgi|Helro1|170808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]