SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|170946 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|170946
Domain Number 1 Region: 176-222,268-277
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000759
Family Spermadhesin, CUB domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|170946
Sequence length 342
Sequence
MTLTIKMTLTMKVTLGILRTSTLQTLQQPYNLPSENIRTPRNLCHAIFLLCLHTVTEFDS
PSATATTTTTTTTTSSTTTTTFKSNLTDYCPYDYFTATCPEDSLIIMTEANYGRMRQGLC
INEHSIGCTADIINYMDSICSGKPKCQVGVSDHSMHRLQTCAKDMLSYLQASYICVYGYL
ASYYTHKMGQGTEACPWKIEVKPGQQIQLVLLDFSIANRYKTDMREVNINNNNHNNHHHH
LQHLSSNNINNIDDNNHDHNQRHQHPIVSDYCHVYAHVVEPEITSGADRKWNVCAGSSRS
SVVYTSRTNRVLVEVSEYVVVERQINFMIKYKSTSLSASVPA
Download sequence
Identical sequences T1F3M1
XP_009015007.1.102002 jgi|Helro1|170946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]