SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|170962 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|170962
Domain Number 1 Region: 9-82
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000937
Family Laminin G-like module 0.044
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|170962
Domain Number - Region: 138-174
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0513
Family BAR domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|170962
Sequence length 241
Sequence
MDFGLFVLTFFDNTWHKIGVSFTPDRFEVFLDCAKVGSAYPHLTNFSHISLNGEIWMGRK
SVDIGIDFDLQWAMINCDPRIPMYENCIDLLPVPRATLTPATDQLLPTTTTSTTTSTTTT
TTTTSTKPLDFFHMPRYRLRNRYNFDLHEIVTERKLLEKQLLKLEIFLTRLEQLIPPKMY
ADVGFDGYDDVLEEEDSRDFGVGYYQRYHQHRNPHQMISDGEYHRATANRGETGRNKYSM
K
Download sequence
Identical sequences T1F3M6
jgi|Helro1|170962 XP_009015023.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]