SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|170963 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|170963
Domain Number 1 Region: 5-105
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000475
Family Laminin G-like module 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|170963
Sequence length 137
Sequence
MTCIQNVTSKVQVVKGSSAYQKAFRIDSTSKLRMSTKRVFWKSIPLSFSLTTTFRLNMDS
FDVSWYVFYIQDHKGRIQFGLQVNPKRKLLRFKLMHPTKRNLQNFDLSLDNEYFAKTYKS
LFTVFQDIFLHLPIDTQ
Download sequence
Identical sequences T1F3M7
XP_009015024.1.102002 jgi|Helro1|170963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]