SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|171551 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|171551
Domain Number 1 Region: 1-96
Classification Level Classification E-value
Superfamily Integrin domains 0.00000000000131
Family Integrin domains 0.0054
Further Details:      
 
Domain Number 2 Region: 326-421
Classification Level Classification E-value
Superfamily Integrin domains 0.0000167
Family Integrin domains 0.0069
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|171551
Domain Number - Region: 164-198
Classification Level Classification E-value
Superfamily Integrin domains 0.068
Family Integrin domains 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|171551
Sequence length 486
Sequence
MNIQVGNKLEDAFSTKLYIILPEQLRYIGSDDKECRRTGTLTVTCDVENPFPHGKYASVA
LRLDASLVDSSVRELYVHLIVNSSSVEVNYDDNEDIFVIKVNLSSDVVILANVQPESMYR
NRQDRYAETLKHSKNTDDDSVVQKASMESSEIKIGKKVSPVFGSTLGDSFEHTFEVKNRG
YTKTASLKLHIQVPLICGGQHRDRSDRGGDYKSSCRYFIDSTTIEFVSDDVDVDCYENDV
NSGGCHQQIITLLCKLISVKLTYQSSITKTHAVWHRKVVLLNYKEDVGIAGNFSFHANMG
ANDDDVDRSKESILSKILKFGSGNDSSEQNVLYLTCDDESMMECISIECSVHPLTRGESA
VVSSSPQVDEIKVTSRARVSIPSSQKTSEDIHAFDSSNFTLTTLTIFLRDNSGIHMHVPI
WALVLSISLGVLALLHVVLIMYKCGFFKRPKRNILAPVHQATVKKPLNIRQMSQPTRFLP
PRPFSR
Download sequence
Identical sequences T1F4E5
jgi|Helro1|171551 XP_009016521.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]