SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|171801 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|171801
Domain Number - Region: 14-54
Classification Level Classification E-value
Superfamily vWA-like 0.0211
Family Integrin A (or I) domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|171801
Sequence length 142
Sequence
MGQNLYNSSTTPVAYDRALKNNVTIITVAFGYPHKVHLPELQSISSDPTFAFNIQVITPH
ILLGKLMSIICREMFAANQAIDYYDCEDNYPCTLENWRKNPTGTFAHKQHNKFVKCSGLT
QCRVDECQQSSSWNNDTKVCES
Download sequence
Identical sequences T1F4P4
jgi|Helro1|171801 XP_009016718.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]