SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|171985 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|171985
Domain Number 1 Region: 21-171
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000000000286
Family Fucose binding lectin 0.026
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|171985
Domain Number - Region: 291-336
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0153
Family EGF-type module 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|171985
Sequence length 420
Sequence
MGGGVVFGRCLQFLLIQILMFHPSETVNLAFKRKVYASSVELDYPPNLASDGVKNVSGKM
AKTLDNSKPGWLVIDLEFVFPIKGVNVYITSDDCWCHMNNFEIWLSNTFDVTVNKSITKT
TLCARAGVVSQGLEVTLNCLLEDARFRYVILHQASNESQLSVTEIEVIGDESYVQYYAGC
FMDFKEAVQTRSVQSLEECFNNRECYCSSVLTSRMLPLIKCEYRCSDEELLSCPKAKNFN
IFRVSPCNYKDSSSWNYCPTHCSDEKPADSLGMCSDCQAGYCGSTCQLRDCYNNNGGCGD
HQCIIQYSNFVDAFECDCNEGYHKSTYDGQCEHVQRSKRKNQPTNSEKVYDNHNSHRSNN
TNNSNSNNNNNFNMRSLSYESPQRDTEYHNYAEIVESTKDNNRGSIFPKKGSPSCLDVLE
Download sequence
Identical sequences T1F4X1
XP_009016911.1.102002 jgi|Helro1|171985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]