SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|172059 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|172059
Domain Number 1 Region: 38-182,249-312
Classification Level Classification E-value
Superfamily Kelch motif 3.79e-34
Family Kelch motif 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|172059
Sequence length 636
Sequence
MNITKHANDHHHVKHITALKDINSTALVLSDDVTKISETEPWPKSRVKHAVCECDGFLYL
FGGRNLNVPLKDSWRYCLKTEKWEELNLIGSRLPHLEGHTATVDNSIIYLFGGSFCNNVI
WKIDTKSMRCAPLYPDGQNNNSSAIPKNRKDHTACVYKNHLFIFGGSIDLLGPTNELWSF
DLAHPCNDESTSWQLLFPVRLGNNCSNNNSNSYQSQIYQPREMSLKNDTSADFKPQNNIT
NNSNYRKEHIPKHGPQPRIRHSCVVIDSSMWIYAGECNESVYSDFWKWNFEDCMWSSISI
GGKCPLIHKQFSTAPYHNTNSGLLFLNYSTNSNASNSFSSSLGSSTSSSNSNSNEDDDLK
LEIFLLDLHNLTWSKPIYTHTLSQQSHSNAFPTDFLIFITTTAPQTCKFLSISEIELSSL
HCQRLSSCLVNSSNFSHGFYNPSFQSHSALDINNDINTQITQSMHIEAVEALKRKIFKRF
HRNSREDLVSGSKVNIEMSYLGGDGGRKKVAKHSENKKLLQTATSQTTIITIDNINSSLS
NSGAGSVVDNSRAVEYFDENKRGISERLVEWRNKKISKNTNTGSNLNGNNSSNNNKFNNS
TSCDLIVDLYMIGGRFKGQVASSPMLFKSISLDINY
Download sequence
Identical sequences T1F4Z5
XP_009016979.1.102002 jgi|Helro1|172059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]