SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|172177 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|172177
Domain Number 1 Region: 38-221
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.51e-28
Family Laminin G-like module 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|172177
Sequence length 496
Sequence
MNGRQGREKKLNTFQKLKSYTEMKLKKPTNECKDMMRCGNGGTCSQFWSSYTCQCSLTGF
VGDSCSQVGVVYEFGQSGGLFTFKYPDSAWPDSQTDQLAFRFLARKSSGVLVRVVSGTSN
DFIQLQLRNGTLQATYNMGLNDHVTEVGGVRVDDGAVHRVVFVRWGGNSSLRLDERSPVY
YYANGPQHTTFNHQMGVLIGGDGRDVTANHFVGLMSGFHWNGLNMFEMENIKLAGHVKTS
HDKQTFHSFFSDYTKIETNSHGNNTPYNLINNNNNNNNNNNNKLEIYGKNRLDDDALTGD
DIDHDDIILATAVVTGTIIFICLVTLAICKMKSRNQGSYKVDSRSQYQYQICLNDVTSVV
NNSVNNNNNNSNNSNNNMNNNVDLASESNRYIIDNDSVNNSNDRSVNNLKSSTLVRGACV
QSNTDANSLAGIGTVLSLKKLSLSSSSGTPSGLNGSSKLGGGAAKKFSKSKNEKSYITKR
LSSSGRCQKEDREWYV
Download sequence
Identical sequences T1F545
jgi|Helro1|172177 XP_009017108.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]