SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|172342 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|172342
Domain Number - Region: 265-373
Classification Level Classification E-value
Superfamily TNF-like 0.000814
Family TNF-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|172342
Sequence length 394
Sequence
MEDDDGIGLSTPPPVIPPRPAATTTTSTTTTFSSPKCSKAKKKNNTKNSKYNMKNCANIV
NNNNNTNNNNTEEEESPPSVPARQPIYSEARSYKPLLNNNINNNINNNIDNNNNNNINNN
NINNTPKHNIINIQYINNDISNNKANRSRSLDINNINNNSNNNSNIKKPATTRKRSKSLT
LTPQKKATAAAAKKKKRDNSKVLFRSQSPFISEMKAHYDQTKNVLSSSPQFKFSEGARKS
DLDNEVIKEFNSVSFENIHHINGTREAVQFNRSDGSLRIEADGLYRITAFVQFIYRQPTE
CFWVRIDKLSDFNEGMNYVEKRNFTLVGGEAHFMGAQIHANGNKFKKILLAKMVWLKDGD
LLRIKKDRQNKLACSEANDLEHNLTFSNFVIYLF
Download sequence
Identical sequences T1F576
jgi|Helro1|172342 XP_009017252.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]