SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|172543 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|172543
Domain Number - Region: 1-45
Classification Level Classification E-value
Superfamily vWA-like 0.0912
Family Integrin A (or I) domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|172543
Sequence length 186
Sequence
MTSGKSSDTIKTKESLQKVLREGISVIIITVGEPFEVTDISEPNLLTQLVWTDYNDDAYH
GDEEVHEIICKVPVVIKPRGSIKRRKLSASQQFNCLLDTTNEFTLLEMTFGSLGRFFTSD
KQGLFPSAAFFNKNTYIQSYGVKVEEFPKIKTVDMVPCSFKSFDLNETATLELLINSVPG
TTHTVL
Download sequence
Identical sequences T1F5H5
jgi|Helro1|172543 XP_009017464.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]