SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|172606 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|172606
Domain Number 1 Region: 309-545
Classification Level Classification E-value
Superfamily Kelch motif 6.54e-51
Family Kelch motif 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|172606
Sequence length 599
Sequence
MDERIEMDVKKADCFDDFRKVVLISMTGGRYDVDGGLLFRASRYYEALVNSGMRDAHDEE
LTLGALSDESLNEIREFLSTLQSYKNNLVLQRTMMKSLESIKEGLIGASYLQICCMSDLY
QKLMFNYLKESTYADILKWSSECMLTEVFKKVREFVLENFRNLELRSDLLTLAPDDVCYL
LESDFFNAESEFDIFNFVIRWITADKSRKQHAEKLLTQVRYSLMTNSEKKRSSEILNEHG
LNICKDEIVVDKFRSVGTIYALGSSTHGRMVFYQGVQSISVYNFMKFSENENKSPRLATL
KFKTSESVKPPMPELGFKTCMVDNCLYLAGGSRYSYFTTNNFFVYNPATSTLTKRCSMYV
PRGEFYFGELAGQLYAVSGRWFGKRTDTVEKYIPEEDRWLTVAPLPVATYSSGGCTCNGS
IYISGGLNKFGSSNQVWRYSPDENQWTEMAQMLTNRSKHIMTSMDRKVIVIGGIRDSELP
SWHFVNSGEIYDFEANQWTYLLTLKKPVFDSAFFTMNNSLYILGREPFSRNGSIDNFIQK
INLSKYLEMNNTSGNGDSNINNDDKKFNDNNNVDGCQIFSYEADRSLIYHFVGIVITSK
Download sequence
Identical sequences T1F5L9
XP_009017519.1.102002 jgi|Helro1|172606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]