SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|172826 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|172826
Domain Number 1 Region: 58-121,196-324
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0000000000942
Family Glycerol-3-phosphate transporter 0.094
Further Details:      
 
Domain Number 2 Region: 613-667
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000677
Family Ovomucoid domain III-like 0.016
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|172826
Domain Number - Region: 705-771
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00785
Family Glycerol-3-phosphate transporter 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|172826
Sequence length 807
Sequence
MAKQVFTKVIKVIRIFDWFIRAGITGLLRFTLWYAIIQNTQISTHINTLALPGPKHVITT
IEKRFDIGSFYSGLIAGSVEIGGASAAVFVSYFGSARHIPGWIGLGALLTGFGALLTIAI
CITQQPHHYHLNRINTNSLTNSSHNYYNNHHLQLQHHNPSHPFDTRYAPSISVGAYYPKP
DDFPDGPPCSDKSADNYRYVLILIVAQLMIGIGGSPLYTLGTTYIDNHVSTRKAPTYIAF
IYACGVFGPILGYGLGALMLLYYVDLLRYDTTTLNLTPSNSKWVGAWWGGFMLIGALLLL
VSVPFYTFPKILVKEIRQLAREDRQKFFSLCDVFTASREHHQQQQQQQQQQHSNTKLLEG
DVNNKNNNNSNNNNNNNDDNANSSNNNNNNNNNNKAGGNGVGAESGKLCRRQNCLPVYHL
TFKLSFHKSCSIQTSTPDDAHFLCTHKHRIIRACLLVSDRQHSKQIFHLPCTKLSATQST
WSPVWGSVAKCPSSVASYSFCPSGVAVPGAVIGILMGGHCLRHCQLTSRGATQLVLALNS
IALAGFGLFFVLGCSNLKIAGITVSYDNYSHYNDLNNYIPLSSNPFFTNNNNVHNNIHNN
TNNNNNNYYNKFNLTSMCNKNCNCDDNSMEFVCGDNGVIYFSPCYAGCVTAAVGNGGKEQ
NYSDCSCVILPSSLSSSPQSPTTGSVHLTSLAEAGMGECVGKCETLVPFMVMLFFMTFVV
TGTQMPLVMVTIRSVCEQEKALALGVQYVMLRLLAYIPAPLIYGSQIDQTCVHWARVCEV
EGNCLVYDLACASCINSSPQCFTLPTG
Download sequence
Identical sequences T1F5Z4
XP_009017703.1.102002 jgi|Helro1|172826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]