SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|173124 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|173124
Domain Number - Region: 113-140
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00012
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 144-176
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000389
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 80-114
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000548
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 177-208
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0825
Family EGF-type module 0.053
Further Details:      
 
Domain Number - Region: 48-79
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0988
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|173124
Sequence length 382
Sequence
MHEERTGTGALYIVLEIFNSMHRPLNGSPLKFRLKKRCLGPDRARHACSYSCKRAERCAD
AGGCHCRPGYVGPRCDQPVCTPACQNGGVCLAPNKCQCPTGFGGRKCDMEVCHCENGGIC
MEHGTCRCLPGFIGARCQHHKTGKCELLCKNGGHCNQLNKCTCPSGYTGHLCQRPLCSNG
CDAHGKCVAPDQCQCFKGWKGNKCNKTEKMSYADNDESAKRRRKRRKLRQSEEDGQRSKT
TSMPGLHVRHWSKHNQSNNKRNSNINNNRRNNNQDSNYRNGFQNKISNNDTFKHDHAFNN
PVNKAIKNKQLYLKNYQTNNNKSAGIMRGESFVNHRVKKNQLFKLVSEPDMTTHYVTSHH
SRPSQLCMSIQQMLFKGYHNIT
Download sequence
Identical sequences T1F6E5
jgi|Helro1|173124 XP_009017986.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]