SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|173373 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|173373
Domain Number 1 Region: 176-332
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000000000473
Family Fucose binding lectin 0.032
Further Details:      
 
Domain Number 2 Region: 16-173
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000113
Family Fucose binding lectin 0.027
Further Details:      
 
Domain Number 3 Region: 648-685
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000542
Family EGF-type module 0.007
Further Details:      
 
Domain Number 4 Region: 607-711
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000022
Family Growth factor receptor domain 0.018
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|173373
Domain Number - Region: 563-617
Classification Level Classification E-value
Superfamily EGF/Laminin 0.029
Family EGF-type module 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|173373
Sequence length 834
Sequence
MLAVVYSCVAVLMVVEVESPFVNVAWKKAAFVSTEYPREVEAGPWRGVDGRKGRTDYVHI
AENDTEMNWFVIDLIHSYQVKYIHLFNRECPDCEERMDHFIIGTTNTFDPTINKTIRNRY
QLCGQWPTKAFPPFRAMRIDCLNPNAFSRFVILQQDVGKSSMGFTELEVYTDGKPIYTKN
LALNKPVYFSTARPGDMYDPKICVDGNFTPDNIYCLQGLESPPYKNWFAIDLLREHMIVY
VVLYGRTDCCVSDMDYFVVGLTNKFDPQVNTTVRNNYRMCGHWKSAALVKGMPMRVTCED
DSFHSRFVIIQQSDLKNNSGLGFKEVEVYANDPIRKKYFGCFRNFRGEKTFPNQHMGKCI
ALCRNANLPFATMNVENFDDCICGSVVGYPVSSINCLVNCTNDKRCIVRDFFTVFEVSEM
AVTTQPEMGCFREKMTPEINENLMLISDGESSCRRCIAHCFKSNFLYASINSLTCQCGNT
YDTLEKVSESHCNVKCATEQSNNCGGSVASRYVNLFLTGYIYGLEMNPYERYHCLNGTKF
DGLNECQECEPGWTGRMCKERDCAVNNGACGSDKCVTHSFAYANISECECRNGYAKVFAQ
GDCRDFHECDHGEHTCNLNTSHCVNTHGSYRCVCRSGYIRSEVDPEDCVDINECNDDNPC
SYEHQVCHNTPGSYQCSCQPGFHVDECCTKIDKCDRSRQYCTNTIGSHICQDHGEDSPTL
KRSLTACVALSILFIISTATLAFIIVYQSKRLLEIKNAVKILYSGTKNQGDITSNNNNNN
KNNNKNKNNNNNNNNKNNDDDDNFISNIMNEEADDDEFSYSNPVYYIIKDETMK
Download sequence
Identical sequences T1F6Q7
jgi|Helro1|173373 XP_009018232.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]