SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|173495 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|173495
Domain Number 1 Region: 41-124
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000144
Family Laminin G-like module 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|173495
Sequence length 218
Sequence
MTFRFTKGDWPDTHADRIAVAFKPETKIKMSVKEEDEEEKNRDATIFRMESGSSADFIEI
YLTKNNSVCALYDVGMGKKLLTSGWSYGDVIIAQRYHVIKFQRSGANASLQVDDGNVSSY
NTSGLVVNGLNVFELASKNHPQVRIEGKGVRLASEMKQNRPAEFELCRHITQTPRMNNAN
LQYMYVGSLGVIMVKLLCESMITLQRSKNGWMICNPQS
Download sequence
Identical sequences T1F6W1
XP_009018349.1.102002 jgi|Helro1|173495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]