SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|173496 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|173496
Domain Number 1 Region: 213-247
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000145
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|173496
Sequence length 251
Sequence
MLGAGWLYCNNINNNHNINNNISININKNNSIIIHNESTTILQMIAHANSSKNGENFNTK
HQNNNNNNNNANNNNNNDNNINNNNINSKQSIYLDLSPDNVVYFGGLSPNPTQRFPSQFP
PPHHQLPSSVKSDGRGFHGCVSSHVIFNDFPYDVIAAAGNKSTDEVSIVKGCLEPENVCE
RSMIASDNINNNINNIYNNINNINNINNDDKNKMAEKRCHNNGVCVQEWGGNECDCQMTS
FSGDKCQDGLL
Download sequence
Identical sequences T1F6W2
jgi|Helro1|173496 XP_009018350.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]