SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|173496 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|173496
Domain Number 1 Region: 213-247
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000145
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|173496
Sequence length 251
Sequence
MLGAGWLYCNNINNNHNINNNISININKNNSIIIHNESTTILQMIAHANSSKNGENFNTK
HQNNNNNNNNANNNNNNDNNINNNNINSKQSIYLDLSPDNVVYFGGLSPNPTQRFPSQFP
PPHHQLPSSVKSDGRGFHGCVSSHVIFNDFPYDVIAAAGNKSTDEVSIVKGCLEPENVCE
RSMIASDNINNNINNIYNNINNINNINNDDKNKMAEKRCHNNGVCVQEWGGNECDCQMTS
FSGDKCQDGLL
Download sequence
Identical sequences T1F6W2
XP_009018350.1.102002 jgi|Helro1|173496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]